E-mail:gzliang@cqu.edu.cn    Tel: (86)2365102507

1 results were reported for Antimicrobial peptides: LNGHGLTLWYGIQNFVDQLDNADDLEDVARK
No. DFBP ID AA sequence Peptide/Function name Organism/Source Precursor protein PubDate
1 DFBPAMIC0526 LNGHGLTLWYGIQNFVDQLDNADDLEDVARK Antimicrobial peptide, Tg-Hb P7 Blood clam (Tegillarca granosa) Hemoglobin 2016
No other studies with the same sequence were reported.
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214