E-mail:gzliang@cqu.edu.cn    Tel: (86)2365102507

1 results were reported for Antimicrobial peptides: NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFNC
No. DFBP ID AA sequence Peptide/Function name Organism/Source Precursor protein PubDate
1 DFBPAMIC0001 NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFNC Antimicrobial peptide, Ct-AMP1 Clitoria ternatea Extraction of seed proteins(Seeds were purchased from Chiltern Seeds (Cumbria, UK) or collected locally (A. hippocastanum)) 1995
No other studies with the same sequence were reported.
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214