E-mail:gzliang@cqu.edu.cn    Tel: (86)2365102507

1 results were reported for Antimicrobial peptides: QGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW
No. DFBP ID AA sequence Peptide/Function name Organism/Source Precursor protein PubDate
1 DFBPAMIC0007 QGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW Antimicrobial peptide, Bovine Beta-defensin 3 Bos taurus (Bovine) Neutrophil protein 1993
No other studies with the same sequence were reported.
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214