E-mail:gzliang@cqu.edu.cn    Tel: (86)2365102507

1 results were reported for Blood-brain barrier peptides: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
No. DFBP ID AA sequence Peptide/Function name Organism/Source Precursor protein PubDate
1 DFBPBBBP0010 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK Blood-brain barrier peptide, Pituitary adenylate Ovine hypothalamic tissues N.D 1989
No other studies with the same sequence were reported.
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214