DFBP ID - DFBPAMIC0009(Antimicrobial peptide) |
DFBP ID |
DFBPAMIC0009 |
Peptide sequence |
QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW |
Type |
Native peptide |
Peptide/Function name |
Antimicrobial peptide, Bovine Beta-defensin 5 |
|
Function-activity relationship |
Main bioactivity |
Antimicrobial activity |
Otheir bioactivity |
N.D |
|
Calculated physicochemical properties |
Three-letter amino acid |
Gln-Val-Val-Arg-Asn-Pro-Gln-Ser-Cys-Arg-Trp-Asn-Met-Gly-Val-Cys-Ile-Pro-Ile-Ser-Cys-Pro-Gly-Asn-Met-Arg-Gln-Ile-Gly-Thr-Cys-Phe-Gly-Pro-Arg-Val-Pro-Cys-Cys-Arg-Arg-Trp |
Single-letter amino acid |
QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW |
Peptide length |
42 |
Peptide mass |
Experimental mass |
Theoretical mass |
N.D |
4807.76 Da c |
|
Net charge |
+6 |
Isoelectric point (pI) |
9.41 c |
IC50 |
N.D |
pIC50 |
N.D |
GRAVY |
-0.2333 c |
Hydrophilic residue ratio |
50% c |
Peptide calculator |
|
|
Peptide source & Food-borne protein(s) search |
Classification |
Animal |
Organism/Source |
Bos taurus (Bovine) |
Precursor protein |
Neutrophil protein |
Residue position |
N.D |
Precursor protein(s) search
|
|
Link-research
|
There are no literature reports on the discovery of this sequence in other food-source proteins. |
|
Biological/Functional activity & target protein |
Antimicrobial activity |
The peptide showed effective bactericidal activity against E.coli ML35 and S.aureus 502A. |
Specific target protein(s) |
N.D |
|
Taste properties & Structure |
Bitterness |
Literature report |
N.D |
Bitter prediction tools |
Non-bitter taste prediction |
|
SMILES |
N[C@@]([H])(CCC(=O)N)C(=O)N[C@@]([H])(C(C)C)C(=O)N[C@@]([H])(C(C)C)C(=O)N[C@@]([H])(CCCNC(=N)N)C(=O)N[C@@]([H])(CC(=O)N)C(=O)N1[C@@]([H])(CCC1)C(=O)N[C@@]([H])(CCC(=O)N)C(=O)N[C@@]([H])(CO)C(=O)N[C@@]([H])(CS)C(=O)N[C@@]([H])(CCCNC(=N)N)C(=O)N[C@@]([H])(CC(=CN2)C1=C2C=CC=C1)C(=O)N[C@@]([H])(CC(=O)N)C(=O)N[C@@]([H])(CCSC)C(=O)NCC(=O)N[C@@]([H])(C(C)C)C(=O)N[C@@]([H])(CS)C(=O)N[C@@]([H])([C@]([H])(CC)C)C(=O)N1[C@@]([H])(CCC1)C(=O)N[C@@]([H])([C@]([H])(CC)C)C(=O)N[C@@]([H])(CO)C(=O)N[C@@]([H])(CS)C(=O)N1[C@@]([H])(CCC1)C(=O)NCC(=O)N[C@@]([H])(CC(=O)N)C(=O)N[C@@]([H])(CCSC)C(=O)N[C@@]([H])(CCCNC(=N)N)C(=O)N[C@@]([H])(CCC(=O)N)C(=O)N[C@@]([H])([C@]([H])(CC)C)C(=O)NCC(=O)N[C@@]([H])([C@]([H])(O)C)C(=O)N[C@@]([H])(CS)C(=O)N[C@@]([H])(Cc1ccccc1)C(=O)NCC(=O)N1[C@@]([H])(CCC1)C(=O)N[C@@]([H])(CCCNC(=N)N)C(=O)N[C@@]([H])(C(C)C)C(=O)N1[C@@]([H])(CCC1)C(=O)N[C@@]([H])(CS)C(=O)N[C@@]([H])(CS)C(=O)N[C@@]([H])(CCCNC(=N)N)C(=O)N[C@@]([H])(CCCNC(=N)N)C(=O)N[C@@]([H])(CC(=CN2)C1=C2C=CC=C1)C(=O)O |
|
Preparation method |
Mode of preparation |
Synthesis |
Enzyme(s)/starter culture |
No enzyme |
|
Stability & Cytotoxicity |
Peptide stability |
|
Peptide cytotoxicity |
|
|
Additional information |
Additional information |
N.D |
|
Database cross-references |
|
|
|
|
Reference(s) |
Primary literature |
Selsted ME, Tang YQ, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS. Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils. J Biol Chem. 1993 Mar 25;268(9):6641-8.
|
Other literature(s) |
N.D |
PubDate |
1993 |
|