E-mail: qindongya@jflab.ac.cn    Tel: 023-68059905

List of peptide properties
DFBP ID - DFBPBBBP0010(Blood-brain barrier peptides)
DFBP ID DFBPBBBP0010
Peptide sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
Type Native peptide
Peptide/Function name Blood-brain barrier peptide, Pituitary adenylate
Function-activity relationship
Main bioactivity Penetrate blood-brain barrier
Otheir bioactivity N.D
Calculated physicochemical properties
Three-letter amino acid His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys
Single-letter amino acid HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK
Peptide length 38
Peptide mass
Experimental mass Theoretical mass
N.D 4535.27 Da c
Net charge 0.00 c
Isoelectric point (pI) 10.80 c
IC50 N.D
pIC50 N.D
GRAVY -1.0605 c
Hydrophilic residue ratio 34.21% c
Peptide calculator
To calculate the physicochemical properties of bioactive peptide.
Peptide source & Food-borne protein(s) search
Classification Animal
Organism/Source Ovine hypothalamic tissues
Precursor protein N.D
Residue position N.D
Precursor protein(s) search
Link-research
There are no literature reports on the discovery of this sequence in other food-source proteins.
Biological/Functional activity & target protein
Penetrate blood-barin barrier The results show that [125I]P38 is able to cross the BBB in both the direction of CNS to blood and blood to brain [1].
Specific target protein(s) N.D
Taste properties & Structure
Bitterness
Literature report N.D
Bitter prediction tools Non-bitter taste prediction
SMILES N.D
Structure Embedded Mol* Viewer
Docking Embedded Mol* Viewer
Preparation method
Mode of preparation Separation
Enzyme(s)/starter culture N.D
Stability & Cytotoxicity
Peptide stability
Literature report: N.D
EHP-Tool: Enzymatic Hydrolysis Prediction Tool (EHP-Tool)
Peptide cytotoxicity
Literature report: N.D
Prediction: ToxinPred
Additional information
Additional information Based on the result of amino acid analysis, the final yield of the peptide was about 1.2 nmole from 2,400 g of ovine hypothalam.
Database cross-references
BIOPEP-UWM [D1] -
APD [D2] -
BioPepDB [D3] -
MBPDB [D4] -
Reference(s)
Primary literature Miyata A , Arimura A , Dahl R R , et al. Isolation of a novel 38 residue-hypothalamic polypeptide which stimulates adenylate cyclase in pituitary cells.[J]. Biochemical & Biophysical Research Communications, 1989, 164(1):567-574.
Other literature(s) [1] Banks WA, Kastin AJ, Komaki G, Arimura A. Passage of pituitary adenylate cyclase activating polypeptide1-27 and pituitary adenylate cyclase activating polypeptide1-38 across the blood-brain barrier. J Pharmacol Exp Ther. 1993 Nov;267(2):690-6. PMID: 8246142.
PubDate 1989
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214