E-mail:gzliang@cqu.edu.cn    Tel: (86)2365102507

Multifunctional peptides
Multi-cross Fun-Relationships
Statistical data Advanced Research
763
Results

Display results per page
Page to
No.
DFBP ID
AA sequence
AA length
Peptide mass
Function counts
Multifunctional activities
1 DFBPMUFU0763 YPFVEPI 7 863.9986 c 2 Opioid and PEP-inhibitory
2 DFBPMUFU0762 YPLG 4 448.5143 c 2 Opioid and Blood-brain barrier
3 DFBPMUFU0761 YPFVEPIP 8 961.1133 c 2 Opioid and PEP-inhibitory
4 DFBPMUFU0760 ASHLGLAR 8 823.9333 c 2 Immunomodulatory and Ileum contracting
5 DFBPMUFU0759 RELEELNVPGEIVESLSSSEESITRINK 28 3158.4185 c 2 Immunomodulatory and Mineral-binding
6 DFBPMUFU0758 KNTMEHVSSSEESIISQETYKQEKNMAINPSK 32 3669.0276 c 2 Immunomodulatory and Mineral-binding
7 DFBPMUFU0757 GYPMYPLPR 9 1093.2981 c 3 Immunomodulatory, Opioid and Ileum contracting
8 DFBPMUFU0756 LLY 3 407.4995 c 2 Immunomodulatory and Regulating
9 DFBPMUFU0755 VEPIPY 6 716.8238 c 2 Immunomodulatory and PEP-inhibitory
10 DFBPMUFU0754 PAGNFLPPVAAAPVM 15 1451.7266 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214