E-mail: gzliang@cqu.edu.cn    Tel: (86)2365102507

Update biopeptide: Antiviral peptides
Update entries 1
The updated entries are shown in the table below:
No. DFBP ID AA sequence Peptide/Function name Organism/Source Precursor protein PubDate
1 DFBPANPE0013 QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK Antiviral peptide Marine turtle (Caretta caretta) Egg white protein 2006
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214