E-mail: gzliang@cqu.edu.cn    Tel: (86)2365102507

Update biopeptide: Multifunctional peptides
Update entries 24
The updated entries are shown in the table below:
No. DFBP ID AA sequence AA length Peptide mass Function counts Multifunctional activities
1 DFBPMUFU0736 YPWTQ 5 693.759 c 2 DPP IV-inhibitory and Opioid
2 DFBPMUFU0737 YPWTQRF 7 997.1186 c 2 DPP IV-inhibitory and Opioid
3 DFBPMUFU0738 γ-EM 4 278.3248 c 2 DPP IV-inhibitory and γ-Glutamyl
4 DFBPMUFU0739 γ-EL 4 260.2848 c 2 DPP IV-inhibitory and γ-Glutamyl
5 DFBPMUFU0740 γ-EF 4 294.3048 c 2 DPP IV-inhibitory and γ-Glutamyl
6 DFBPMUFU0741 γ-EW 4 333.3448 c 2 DPP IV-inhibitory and γ-Glutamyl
7 DFBPMUFU0742 γ-EY 4 310.3048 c 2 DPP IV-inhibitory and γ-Glutamyl
8 DFBPMUFU0743 KLPGF 5 560.689 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
9 DFBPMUFU0744 EVSGL 5 503.549 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
10 DFBPMUFU0745 QITKPN 6 699.8038 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
11 DFBPMUFU0746 AEAGVD 6 560.5538 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
12 DFBPMUFU0747 EAGVD 5 489.479 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
13 DFBPMUFU0748 NVLQPS 6 656.7338 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
14 DFBPMUFU0749 LEPINF 6 731.8338 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
15 DFBPMUFU0750 ANENIF 6 706.7438 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
16 DFBPMUFU0751 PAGNFLMNGLMHR 13 1457.7271 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
17 DFBPMUFU0752 PAVACCLPPLPCHM 14 1451.8419 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
18 DFBPMUFU0753 MLPLMLPFTMGY 12 1413.8024 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
19 DFBPMUFU0754 PAGNFLPPVAAAPVM 15 1451.7266 c 2 α-Amylase inhibitory and α-Glucosidase inhibitory
20 DFBPMUFU0755 VEPIPY 6 716.8238 c 2 Immunomodulatory and PEP-inhibitory
21 DFBPMUFU0756 LLY 3 407.4995 c 2 Immunomodulatory and Regulating
22 DFBPMUFU0757 GYPMYPLPR 9 1093.2981 c 3 Immunomodulatory, Opioid and Ileum contracting
23 DFBPMUFU0758 KNTMEHVSSSEESIISQETYKQEKNMAINPSK 32 3669.0276 c 2 Immunomodulatory and Mineral-binding
24 DFBPMUFU0759 RELEELNVPGEIVESLSSSEESITRINK 28 3158.4185 c 2 Immunomodulatory and Mineral-binding
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214