E-mail: gzliang@cqu.edu.cn    Tel: (86)2365102507

1 results were reported for Anticancer peptides: GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
No. DFBP ID AA sequence Peptide/Function name Organism/Source Precursor protein PubDate
1 DFBPANCA0061 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE Anticancer peptide, Pardaxin Pardachirus marmoratus Red Sea moses sole [2] 2015
No other studies with the same sequence were reported.
Copyright © 2020. Record / license number: Chongqing ICP No. 2000214