|
||||||||||
No. |
DFBP ID  |
AA sequence  |
Peptide/Function name |
AA length |
Peptide mass |
Organism/Source
|
Precursor protein |
PubDate |
| 1 | DFBPBBBP0012 | RGGRLSYSRRRFSTSTGR | Blood-brain barrier peptide, SynB1 | 18 | 2099 Dc | Porcine leukocytes | N.D | 2002 |
| 2 | DFBPBBBP0011 | RRLSYSRRRF | Blood-brain barrier peptide | 10 | 1396.59 Da c | Porcine leukocytes | N.D | 2002 |
| 3 | DFBPBBBP0010 | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK | Blood-brain barrier peptide, Pituitary adenylate | 38 | 4535.27 Da c | Ovine hypothalamic tissues | N.D | 1989 |
| 4 | DFBPBBBP0009 | HSDGIFTDSYSRYRKQMAVKKYLAAVL | Blood-brain barrier peptide, Pituitary adenylate | 27 | 3148.59 Da c | Ovine hypothalamic tissues | N.D | 1900 |
| 5 | DFBPBBBP0008 | YPLG | Blood-brain barrier peptide, Melanocyte-stimulati | 4 | 448.51 Da c | Bovine hypothalamus | N.D | 1989 |
| 6 | DFBPBBBP0007 | PLG | Blood-brain barrier peptide, Melanocyte-stimulati | 3 | 285.34 Da c | Bovine hypothalamic tissue | N.D | 1971 |
| 7 | DFBPBBBP0006 | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | Blood-brain barrier peptide, Exendin-4 | 39 | 4184 Da | The saliva of the Gila monster | N.D | 2003 |
| 8 | DFBPBBBP0005 | YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY | Blood-brain barrier peptide, Neuropeptide Y | 36 | 4254.62 Da c | Porcine brain | N.D | 1999 |
| 9 | DFBPBBBP0004 | HSDAVFTDNYTRLRKQMAVKKYLNSIL | Blood-brain barrier peptide, Pituitary adenylate | 27 | 3212.68 Da c | Porcine intestinal extracts | N.D | 2003 |
| 10 | DFBPBBBP0003 | CYIQNCPLG | Blood-brain barrier peptide, Oxytocin | 9 | 1007 Da | Bovine hypothalamus | N.D | 2000 |
PathWay Map
Fun-Relationships
Statistical data
Advanced Search