|
||||||||||
No. |
DFBP ID  |
AA sequence |
Peptide/Function name |
AA length |
Peptide mass |
Organism/Source
|
Precursor protein |
PubDate  |
| 1 | DFBPANCA0863 | TSKYR | Anticancer peptide, α137-141 (NKT) | 5 | 653.73 Da c | Bovine and human hemoglobin | Bovine and human hemoglobin | 2023 |
| 2 | DFBPANCA0867 | RIIDLLWRVRRPQKPKFVTVWVR | Anticancer peptide, PMAP-23 | 23 | 2962.60 Da c | Sythesis | Sythesis peptide | 2023 |
| 3 | DFBPANCA0657 | GWGSFFKKAAHVGKHVGKAALTHYL | Anticancer peptide, Pleurocidin (Ple) | 25 | 2711.17 Da | Winter flounder Pleuronectes americanus | Sythesis peptide | 2022 |
| 4 | DFBPANCA0686 | KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK | Anticancer peptide | 46 | 4834.46 Da c | Sythesis | Sythesis peptide | 2022 |
| 5 | DFBPANCA0658 | GWGSFFKKAAHVGKHVGKAALTHYL | Anticancer peptide, Pleurocidin-a (Ple-a) | 25 | 2710.18 Da | Sythesis | Sythesis peptide | 2022 |
| 6 | DFBPANCA0602 | GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP | Anticancer peptide, RANATUERIN2 | 31 | 3188.85 Da c | Sythesis | Sythesis peptide | 2021 |
| 7 | DFBPANCA0386 | FIHHIFRGIVHAGRSIGRFLTG | Anticancer peptide, piscidins 3 (P3) | 22 | 2492 Da | Sythesis | Sythesis peptide | 2021 |
| 8 | DFBPANCA0385 | FFHHIFRGIVHVGKTIHRLVTG | Anticancer peptide, piscidins 1 (P1) | 22 | 2571 Da | Sythesis | Sythesis peptide | 2021 |
| 9 | DFBPANCA0061 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Anticancer peptide, Pardaxin | 33 | 3323.81 Da c | Pardachirus marmoratus | Red Sea moses sole [2] | 2015 |
| 10 | DFBPANCA0038 | GLLDTLKGAAKNVVGSLASKVMEKL | Anticancer peptide, Pentadactylin | 25 | 2540.5 Da | Leptodactylidae, Pepper frog (Leptodactylus labyrinthicus) | Skin secretions | 2011 |
PathWay Map
Fun-Relationships
Statistical data
Advanced Search