|
||||||||||
No. |
DFBP ID |
AA sequence |
Peptide/Function name |
AA length |
Peptide mass |
Organism/Source
|
Precursor protein |
PubDate |
| 1 | DFBPAMIC0005 | FKCRRWQWRMKKLGAPSITCVRRAF | Antimicrobial peptide, Lactoferricin B | 25 | 3125.80 Da c | Bos taurus (Bovine) | Lactoferrin | 1992 |
| 2 | DFBPAMIC0019 | GLFLDTLKGAAKDVAGKLEGLKCKITGCKLP | Antimicrobial peptide, RANATUERIN 2 | 31 | 3188.85 Da c | American bull frog, Rana catesbeiana | The extract of the skin of the adult american bullfrog | 1998 |
| 3 | DFBPAMIC0033 | GWGSFFKKAAHVGKHVGKAALTHYL | Antimicrobial peptide, Pleurocidin | 25 | 2711.16 Da c | Winter flounder, Pleuronectes americanus | The skin mucous secretions | 1997 |
| 4 | DFBPAMIC0084 | RIIDLLWRVRRPQKPKFVTVWVR | Antimicrobial peptide, PMAP-23 | 23 | 2962.50 Da | Pig (Sus scrofa) | Myeloid cells | 1994 |
| 5 | DFBPAMIC0091 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | Antimicrobial peptide, PR-39 | 39 | 4720.61 Da c | Pig, Sus scrofa | Pig intestine | 1991 |
| 6 | DFBPAMIC0110 | FFHHIFRGIVHVGKTIHRLVTG | Antimicrobial peptide, Piscidin 1 | 22 | 2572.06 Da c | Hybrid striped bass (Morone saxatilis x Morone chrysops) | Mast cells, gill, skin, intestine, spleen and anterior kidney | 2001 |
| 7 | DFBPAMIC0111 | FIHHIFRGIVHAGRSIGRFLTG | Antimicrobial peptide, Piscidin 3 | 22 | 2491.91 Da c | hybrid striped bass (Morone saxatilis x Morone chrysops) | The mast cells of fish | 2001 |
| 8 | DFBPAMIC0127 | GLLDTLKGAAKNVVGSLASKVMEKL | Antimicrobial peptide, Pentadactylin | 25 | 2540.50 Da | South American bullfrog (Leptodactylus pentadactylus) | The skin secretions of the bullfrog | 2005 |
| 9 | DFBPAMIC0136 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Antimicrobial peptide, Pardaxin | 33 | 3323.81 Da c | Red Sea moses sole, Pardachirus marmoratus | Red Sea moses sole | 1988 |
| 10 | DFBPAMIC0156 | GRRKRKWLRRIGKGVKIIGGAALDHL | Antimicrobial peptide, NRC-3 | 26 | 2954.00 Da | Winter flounder 1a-1, Pleuronectes americanus | Flatfish | 2003 |