|
||||||||||
No. |
DFBP ID |
AA sequence |
Peptide/Function name |
AA length |
Peptide mass |
Organism/Source
|
Precursor protein |
PubDate |
1 | DFBPAMIC0527 | QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK | Antimicrobial peptide |
26 | 4080.03 Da c | Marine turtle (Caretta caretta) | Egg white protein | 2006 |
2 | DFBPAMIC0054 | GICACRRRFCPNSERFSGYCRVNGARYVRCCSRR | Antimicrobial peptide, Rabbit neutrophil defensin 3a | 34 | 3993.00 Da | Rabbit, Oryctolagus cuniculus | Peritoneal neutrophil protein | 1985 |
3 | DFBPAMIC0136 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Antimicrobial peptide, Pardaxin | 33 | 3323.81 Da c | Red Sea moses sole, Pardachirus marmoratus | Red Sea moses sole | 1988 |
4 | DFBPAMIC0476 | SWSSFFKKAAHSGKHVGKSASTHYLG | Antimicrobial peptide, Pleurocidin analogue from Pleuronectes americanus | 26 | 2806.12 Da c | Winter flounder (Pleuronectes americanus) | Pleurocidin analog | 2008 |
5 | DFBPAMIC0474 | RWRSFFKKAAHRGKHVGKRARTHYLG | Antimicrobial peptide, Pleurocidin analogue from Pleuronectes americanus | 26 | 3151.67 Da c | Winter flounder (Pleuronectes americanus) | Pleurocidin analog | 2008 |
6 | DFBPAMIC0287 | FKCRRWQWRMKKLGAPSITCVRRAFA | Antimicrobial peptide, f(17-42) of bovine lactoferrin | 26 | 3196.88 Da c | Bovine | Lactoferrin(LF) | 1997 |
7 | DFBPAMIC0473 | RWRSFFKKAAHRGKHVGKRARTHYL | Antimicrobial peptide, Pleurocidin analogue from Pleuronectes americanus | 25 | 3094.61 Da c | Winter flounder (Pleuronectes americanus) | Pleurocidin analog | 2008 |
8 | DFBPAMIC0033 | GWGSFFKKAAHVGKHVGKAALTHYL | Antimicrobial peptide, Pleurocidin | 25 | 2711.16 Da c | Winter flounder, Pleuronectes americanus | The skin mucous secretions | 1997 |
9 | DFBPAMIC0127 | GLLDTLKGAAKNVVGSLASKVMEKL | Antimicrobial peptide, Pentadactylin | 25 | 2540.50 Da | South American bullfrog (Leptodactylus pentadactylus) | The skin secretions of the bullfrog | 2005 |
10 | DFBPAMIC0197 | VYQHQKAMKPWIQPKTKVIPYVRYL | Antimicrobial peptide | 25 | 3115.77 Da c | Bovine | αs2-Casein | 1999 |