|
||||||||||
No. |
DFBP ID  |
AA sequence  |
Peptide/Function name |
AA length |
Peptide mass |
Organism/Source
|
Precursor protein |
PubDate |
| 1 | DFBPAMIC0005 | FKCRRWQWRMKKLGAPSITCVRRAF | Antimicrobial peptide, Lactoferricin B | 25 | 3125.80 Da c | Bos taurus (Bovine) | Lactoferrin | 1992 |
| 2 | DFBPAMIC0033 | GWGSFFKKAAHVGKHVGKAALTHYL | Antimicrobial peptide, Pleurocidin | 25 | 2711.16 Da c | Winter flounder, Pleuronectes americanus | The skin mucous secretions | 1997 |
| 3 | DFBPAMIC0054 | GICACRRRFCPNSERFSGYCRVNGARYVRCCSRR | Antimicrobial peptide, Rabbit neutrophil defensin 3a | 34 | 3993.00 Da | Rabbit, Oryctolagus cuniculus | Peritoneal neutrophil protein | 1985 |
| 4 | DFBPAMIC0127 | GLLDTLKGAAKNVVGSLASKVMEKL | Antimicrobial peptide, Pentadactylin | 25 | 2540.50 Da | South American bullfrog (Leptodactylus pentadactylus) | The skin secretions of the bullfrog | 2005 |
| 5 | DFBPAMIC0136 | GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE | Antimicrobial peptide, Pardaxin | 33 | 3323.81 Da c | Red Sea moses sole, Pardachirus marmoratus | Red Sea moses sole | 1988 |
| 6 | DFBPAMIC0171 | GWGSFFKKAAHVGKHVGKAALTHYL | Antimicrobial peptide, NRC-4 | 25 | 2711.00 Da | winter flounder 2 2.1, Pleuronectes americanus | Flatfish | 2003 |
| 7 | DFBPAMIC0178 | VVAPFPE | Antimicrobial peptide, 7 | 7 | 757.88 Da c | Caprine milk (cheese) | αs1-Casein | 2005 |
| 8 | DFBPAMIC0185 | PYVRYL | Antimicrobial peptide | 6 | 809.95 Da c | Ovine milk | αs2-Casein | 2006 |
| 9 | DFBPAMIC0186 | LKKISQ | Antimicrobial peptide | 6 | 715.88 Da c | Ovine milk | αs2-Casein | 2006 |
| 10 | DFBPAMIC0194 | LKKISQRYQKFALPQY | Antimicrobial peptide | 16 | 2011.38 Da c | Bovine | αs2-Casein | 1999 |
PathWay Map
Fun-Relationships
Statistical data
Advanced Search